PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000069.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 776aa    MW: 89119.5 Da    PI: 8.011
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000069.1_g00026.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.73.6e-2728114191
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                              +fY+eYAk+vGF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk++++gkw+++++++eHn
  Itr_sc000069.1_g00026.1  28 EFYKEYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQSGKWYIHSFVKEHN 109
                              6****************************************999877....9********************************** PP

                     FAR1  87 Helap 91 
                              Hel p
  Itr_sc000069.1_g00026.1 110 HELLP 114
                              **975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.3E-2528114IPR004330FAR1 DNA binding domain
PfamPF105517.2E-19227319IPR018289MULE transposase domain
PROSITE profilePS5096610.2506542IPR007527Zinc finger, SWIM-type
PfamPF044349.3E-8512540IPR007527Zinc finger, SWIM-type
SMARTSM005751.4E-7517544IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MESSVVAGSS NLEPRDDMEF DSHEAAYEFY KEYAKSVGFG TAKLSSRRSR ASKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQSGKWY IHSFVKEHNH ELLPAQVHLF  120
RSHRNGDPLK NDPKVRRKKA LAAVSNHYGT YQFSSSLENV FRSQHDRGRN LSLEEGDAQV  180
LLEFFVHMQE ENPEFFYAID LNEEHRLRNV FWVDAKGMED YANFGDVVSL DISYFSNKHK  240
IPLVFFIGVN NHIHPTLMGC ALIVDESVHT FLWLLRTWCL AMGGRGPRVL LTDQNNAIKA  300
AVSAVLPNTH HYFNLWCILE KIPRYLDYLS LWHDPFIAKF RKCIHMSWTE EQFEKRWWKL  360
IDRFNLREDE WIQSLHEDRK RWVPTFIRDV SFAGLSTASR AESMNSLLDK YINGETSLRE  420
FIGKYKLILE DRYEEEAKAN FDAWHETAEL KSPSPFEKQL SLIYTHEIFK KFQVEVLGVA  480
ACHLRKEKDD TTMTYAVKDI ENDQEFMVEW TESKSEIFCS CHLFEYKGFL CRHAIVVLQM  540
SGVFRIPIKY ILQRWSNIAK SRLPISERLD EVQAKVRCYN DLCRRAIILG EEGSLSQESY  600
NIAVSAIKEA IRQCAAANGP TQTDLRPPGM PATLAIQGVE EANHKSTAVA REQVSNIKVT  660
QTSRGTKRVD SGNEKESNES CANKKGKVPL EPEVTNLGTQ GVFHQMPGLS NLLPKVSYNI  720
AEGWQKESAS KWGLRGEIVV NLALSAAKHV TIWTVLPFSA IVLQMRQPTN LTLHLH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491113.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X3
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLK4BMW20.0K4BMW2_SOLLC; Uncharacterized protein
STRINGSolyc03g121630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4